DPCstruct | MC31797
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 225 ± 44 aa |
| Standard deviation of domain lengths | 44.24 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 71.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.35 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0020- CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H5HJB4 | 170-354 | NGKERMQKLAKLAKKHRNGYMPEIDWLDRLTFREIEHINEAEKRQSNYLYLMVEFPQVTLSGVNHSIVWYEQDGDEVYQFRAQAEMV… |
| A0A6J3PTZ4 | 171-380 | QMSRLAKLTKAHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDGDESSPILTSFEIVKVPD… |
| A0A7S3FH78 | 106-350 | None |
| C9SAZ1 | 13-294 | None |
| A0A6A4GU72 | 8-215 | None |
| A0A818ZA48 | 168-424 | None |
| A0A162PUY9 | 137-395 | None |
| Q0CKJ5 | 171-452 | None |
| A0A4P9YUY4 | 235-366 | None |
| A0A7R8W827 | 174-400 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.