DPCstruct | MC31796
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 132 ± 13 aa |
| Standard deviation of domain lengths | 13.02 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 20.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3JFN2 | 1-128 | MLEVAFDLIDKEVHVDWPILKRALVHSIWTPNKKYTKEGEDIVCEELTEEEQSLYDGYVMSTRKREFERYGIEVNTNAGAPNKAVAL… |
| A0A372R099 | 45-164 | KTIDIAREKVGERIFVGWPFLQEGKVQAISDEQFRYELINGQINKIPHKQEISEKWRRKADKFEQDNSKRYGTIIGKVNVFAHVLVL… |
| Q75JF5 | 702-837 | None |
| A0A1R1XHG3 | 390-520 | None |
| A0A7S2W116 | 178-355 | None |
| D3BCJ3 | 187-299 | None |
| A0A368FT89 | 9-144 | None |
| A0A7S1FGU1 | 127-264 | None |
| A0A2G8LDI3 | 18-165 | None |
| A4HSR7 | 672-798 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.