DPCstruct | MC31793
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 134 ± 17 aa |
| Standard deviation of domain lengths | 17.40 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812RQV4 | 170-307 | IRKRDWKPIAHKHLLGRRVILHTDGARAYKMKLDKVIHCNVVHKQKKKIVRGKVTWEKPHYTKVYDLKLPDGQKLTVKSGTQIIDRC… |
| A0A813LWG4 | 1-103 | MKKKLAVNGKVVKKNGQCVWIRPKYTKKFTRELPAGKKIIRMGGAQIIDRFWSHLRGFMEFRQVKVGSAQTSVRTRSAQWDYWRRDQ… |
| A0A1Q9E6D3 | 152-291 | None |
| A0A1Q9CQE9 | 233-355 | None |
| A0A812PAA4 | 275-414 | None |
| A0A812NWG9 | 1-164 | None |
| A0A812MN46 | 1-111 | None |
| A0A813APX2 | 270-411 | None |
| A0A812YKL0 | 337-478 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.