DPCstruct | MC31792
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 77 ± 8 aa |
| Standard deviation of domain lengths | 8.31 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.17 |
| Pfam Score | 60.00 |
| Assigned Pfam label(s) | CL0489- PF07683 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812JM77 | 11-81 | LKEIRKNLRFGLSDRVLCNCGPLWLSGGIVGSAVESEGELFPYVVKTDPLPGLPSRTISVPGDNEHVCIQE |
| A0A812SY84 | 13-90 | DAPWPPLPELRFDVNTRVECRVGPHPVRGWAAGVIVATFYKEPEWPPGMVAPYQIQLDDGRLIFAPQDIDEVIRPEAK |
| A0A7S0ERR7 | 3-70 | None |
| A0A1E7F1F6 | 158-225 | None |
| A0A7S3SMN6 | 19-105 | None |
| A0A7S3SJJ2 | 190-274 | None |
| A0A1Q9CQE1 | 174-252 | None |
| A0A7S2PL62 | 76-159 | None |
| C1DZ29 | 615-687 | None |
| A0A7S4IX51 | 70-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.