DPCstruct | MC3179
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 669 ± 58 aa |
| Standard deviation of domain lengths | 58.19 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 20.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07692 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1UUK0 | 16-600 | IFMHALSSNDGKYMGKSSREYANTVVMSYFDSTDAAKRALIPEAIVVLNLWMYLAHELFETLSNCRMNVIKDKDGIHSIDEAVAYWV… |
| A0A6N8Z245 | 150-850 | IGHHHGHGTGTGTGSVSGAMAMMDKGVSGGVMIPTNLSYETSGPTKSDGYYTPTTNREIYQKISTDYQEILKLTNVIKEGKPLPAAE… |
| D8LDE3 | 1-718 | None |
| K0RDB9 | 1-658 | None |
| A0A7S2RJ80 | 4-705 | None |
| A0A7S0CQX8 | 355-977 | None |
| A0A7S0UKB0 | 2-558 | None |
| A0A6S8BKD8 | 176-914 | None |
| A0A7S4T9X3 | 25-740 | None |
| A0A096P997 | 53-741 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.