DPCstruct | MC31789
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 329 ± 58 aa |
| Standard deviation of domain lengths | 58.21 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812SF65 | 7-296 | YILESVLTFSKLEVLVYDLLTIEAWKEHVFPLLSEPLAGRNSMRLYFILYHEATVINLLEVFLYHKHVCEGGGEKLLELVDYVARKM… |
| A0A0H5QTV1 | 33-352 | TNKLPVLIHRLITLEAFRHNILPEFFKSDIDDVTAIKLYLILYQETTVFTILLTSFYQLSAIESVMDFLVEICDYCHRRLLTLNSGL… |
| U6LWA8 | 3-350 | None |
| A0A3F2RXV6 | 41-421 | None |
| A0A2P6NFZ4 | 12-412 | None |
| A0A0M0KAD8 | 54-410 | None |
| A0A7J6Q8T1 | 59-462 | None |
| A0A5A8DDD4 | 18-368 | None |
| F4P107 | 57-337 | None |
| A0A812WHB8 | 41-416 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.