DPCstruct | MC31788
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 85 ± 6 aa |
| Standard deviation of domain lengths | 5.69 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 55.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812RKK5 | 19-94 | VSEDISDFEYSPMAKYPGPFRIFNVDNEEQLLRKFVSHVQELRPHVIVTYNGDFFDWPYVDSRCSNYALSLYKELG |
| A0A6A5AWE1 | 67-152 | SYMVDRQGFLICNKEFVSQDVDDFEYTPKPEYPGPFECINVANELELIRYFFNHVKELNPHIFVTYNGDFFDWPFLETRAQHHGYS |
| A0A452YAY7 | 158-247 | None |
| A0A812XPU4 | 1-87 | None |
| A0A287F4V8 | 369-448 | None |
| A0A3L6FXY0 | 80-168 | None |
| A0A0M0K3P2 | 80-158 | None |
| A0A4Z2BBN7 | 224-304 | None |
| A0A199VB15 | 79-164 | None |
| A0A183KUH9 | 250-334 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.