DPCstruct | MC31786
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 240 ± 10 aa |
| Standard deviation of domain lengths | 9.59 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 88.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M5GBM9 | 450-695 | CGQHNMAEIGFQGMTVKSGKSVAPALQVLLGGGQFGDGKGRFADKVIKIPSKRGPHAFRRLLNDFEKESGEGERFTEYYERQGKTYF… |
| A0A812QZ61 | 31-272 | VASIGLHGSSIKKGDKVIPAMQVVIGGGVNHDGQGYIAEKVIKLPTKRIPDAVRSLLDDYESNSGEGEYFNQYFRRLGKVYFYDLLK… |
| A0A7C1WXU0 | 111-354 | None |
| A0A832AK64 | 251-496 | None |
| A0A7Y2GQ63 | 2-244 | None |
| A0A849IL13 | 2-236 | None |
| A0A7V1ECH2 | 395-629 | None |
| A0A1F6CGT8 | 468-716 | None |
| A0A838SC90 | 282-519 | None |
| A0A3D1E7P0 | 1-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.