DPCstruct | MC31785
Metacluster Properties and Pfam Annotations
| Number of structural domains | 117 |
|---|---|
| Mean domain length (aa) | 182 ± 41 aa |
| Standard deviation of domain lengths | 41.48 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 85.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.13 |
| Pfam Score | 98.75 |
| Assigned Pfam label(s) | CL0063- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812QVY4 | 242-413 | GAEVILVSGPVSQPDPESVTIIKTETARDMLDAVLDNLPVDVAVCAAAVADWRVDNEQGSKIKKDESGQVPALNFTENPDILKTISN… |
| A0A7W1FM12 | 16-209 | DAVRFISVAASGATALQVKDCLHHQGLSADLLLGIDASPNAPAQRYVDRRGLESALRQWITVNPTGVVVMSAAVNDYEVAQVAIEQP… |
| T0D0S9 | 2-139 | None |
| A0A7K0VRD9 | 8-154 | None |
| A0A6I9JAP8 | 69-229 | None |
| A0A835H3G1 | 307-526 | None |
| A0A7M5XFK3 | 85-309 | None |
| A0A067BWC4 | 123-336 | None |
| A0A5M8P9G4 | 2-178 | None |
| A0A832HCG9 | 194-403 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.