DPCstruct | MC31781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 282 ± 55 aa |
| Standard deviation of domain lengths | 55.35 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 26.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0083 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W8CT95 | 12-304 | VSKYYSTFDEKYRAVLDTVNMAAVEGALKYVQAECINASVVTSCKRKNNIQYIVFYQTTVVQPAAAMQHYANAADEHNYAVERCPFM… |
| A0A812NU96 | 74-378 | YSVNKTALPWKDGSLNSPSGAPLFTFYMYRAVSDEVYPPLNTNVASLPGVLWYLHHEVVIQAPRKFQISRILRYKVQMRATAPLLRL… |
| A0A3F2RDF6 | 16-389 | None |
| A0A6A3MFJ6 | 582-965 | None |
| W4G8E1 | 40-378 | None |
| A0A1V9YPZ5 | 804-1128 | None |
| A0A812Q803 | 61-318 | None |
| A0A812NFJ0 | 244-521 | None |
| A0A812MKW8 | 2-230 | None |
| A0A7S2LML8 | 59-353 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.