DPCstruct | MC31780
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 122 ± 16 aa |
| Standard deviation of domain lengths | 16.26 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R1EB19 | 223-349 | GLDERARRAAAVAALFGRDGFRSTNSHVIDAVSRFKAVRLSALSTEVLSTSVASEEQRALLHSYAEPAHLGGVDAFVSHSWGDDAEA… |
| A0A812KGY4 | 429-526 | WPALLQMGRKNLRCVDWAALSPAVLKGSGGGNMSDFALSRSVRRGEIIDFFVSHSWSDSPARKWKAFQLVAEDFYEKNGRYPTFWID… |
| R1DYT9 | 477-621 | None |
| R1ESF1 | 161-291 | None |
| A0A812QC18 | 36-134 | None |
| R1EBV3 | 334-463 | None |
| A0A812X792 | 1-132 | None |
| A0A7S2JDJ2 | 2-144 | None |
| A0A7S2GTD6 | 52-151 | None |
| A0A7S2FHB6 | 235-332 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.