DPCstruct | MC31775
Metacluster Properties and Pfam Annotations
| Number of structural domains | 163 |
|---|---|
| Mean domain length (aa) | 208 ± 47 aa |
| Standard deviation of domain lengths | 47.05 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 78.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 15.02 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0611- PF21738 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1I2F8 | 710-890 | DAAERKRFAGDAHEYLIEQVQFTGDESIPASVSSSTQKIRLAFNHPVKELIWVITPETSAAVDPKNGNMLFDFGQIAGVDYIQSAKL… |
| A0A6P8ZL18 | 81-296 | ERIKLLDATLYIRKVAISPSVMLGHAQALEKSPAKYPVNRVDIKTVTITQGLRDKNLDNLFMNQLPQRIIIGFVDNRAFNGDYARNG… |
| V4AFY0 | 5-147 | None |
| B0ELU8 | 177-421 | None |
| V4BP68 | 5-237 | None |
| V4C692 | 2-137 | None |
| V4CBZ6 | 1-135 | None |
| G0NY73 | 229-436 | None |
| A0A6V7WCE9 | 406-612 | None |
| A0A2G5UIE7 | 573-777 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.