DPCstruct | MC31773
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 275 ± 28 aa |
| Standard deviation of domain lengths | 27.52 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5M3W3J4 | 75-366 | PADWVKVPARRPRSPVPPPARTAKRVRTILDPDIPADTRKALQADLALVRHVRTGSPWSRYRSGQDGWRPQARFIVCVLAFIWLSPS… |
| A0A429G962 | 1-268 | MVDPSLPPGDRDMLAESADGLTAAGDEPPKSGGRTSADRWWALGVATACGFAPAATLPWLLGGIGALLGVLAQVGTALLWWRFGFGA… |
| A0A495L3Y7 | 95-370 | None |
| A0A1D8T6J0 | 60-351 | None |
| A0A327U167 | 15-333 | None |
| A0A1H8BBP4 | 1-317 | None |
| A0A7K1L2R6 | 4-247 | None |
| A0A840WL08 | 10-221 | None |
| A0A1Q4X3Z1 | 5-275 | None |
| A0A2W6RYG1 | 5-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.