DPCstruct | MC3177
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 184 ± 41 aa |
| Standard deviation of domain lengths | 40.61 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 94.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 29.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02514 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832U2N0 | 3-94 | GYSGGSMMSDFVNNLFGWEVSDPELVDDTVWQDVYETYVNDPSMKEWFKKNNPNAYQSVTARMLEAVRHDYWKPSEDVVENLAKEYE… |
| A0A6N8YW64 | 1062-1274 | DLAEVYTAWGGYAYTQRDFGVSARPQFRQRFGQIVVAAKNQDNREHDVFDSDDYMQYHGGMIATVRALTGQNPRQFFGDSSDPSRSR… |
| A0A1E3H0K6 | 566-768 | None |
| A0A0B8PAX8 | 9-177 | None |
| A0A101WV74 | 7-156 | None |
| A0A7C2WM10 | 15-208 | None |
| A0A847PTL9 | 48-260 | None |
| A0A7X7HTR3 | 194-397 | None |
| A0A1U7PZB8 | 649-852 | None |
| A0A7S1TGH0 | 702-899 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.