DPCstruct | MC31769
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 103 ± 18 aa |
| Standard deviation of domain lengths | 17.56 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G2HY67 | 4-89 | KKLNHNIFVFDTLGIRESIKIRHKAKGFSKFKSETVSGWFPSCDFLDGVQKQRIIDKGNNKYFEIVKDEKLGKIIHICYELLSNHR |
| A0A7V3LEE5 | 20-117 | KLCPYCGSVKRDIKVEIKEEVKVRASLRGRQKRKGFKKFMIEFLQGWFPSKNKSRFPDGVQKERVINKESDRYQEKVTDATTGAVVV… |
| A0A853F601 | 38-131 | None |
| A0A521WKA2 | 1-127 | None |
| U7SNP6 | 167-249 | None |
| A0A451GEV5 | 8-111 | None |
| A0A1H6RPE0 | 9-140 | None |
| D5BV43 | 16-103 | None |
| B9L4K6 | 1-95 | None |
| A0A497IMC7 | 24-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.