DPCstruct | MC31768
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 159 ± 40 aa |
| Standard deviation of domain lengths | 39.85 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 85.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 32.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14753 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834ES02 | 22-183 | QWEKNAALSAIQTGLYIGWRCPHYLWDCFRIGDESKCFCGHLLREHQIVSDISVPCNVNQCRCLMFCFIPSRPEEVGQFWLRRRASF… |
| A0A7S3VH60 | 13-194 | AVSQYGVAPGARKMMDWEEEAAEQAISTGMYVTFRSSPRMDCTRVGPHSKCFCGHLYSEHSFISKKSVYPRCHNCECTGFQFIPRRP… |
| A0A5B8MF94 | 38-154 | None |
| H9GHH7 | 348-469 | None |
| A0A0N0P400 | 90-316 | None |
| A0A0V0QT66 | 56-197 | None |
| A0A0V0QSN8 | 4-194 | None |
| A0A0V0Q7Q0 | 18-186 | None |
| A0A1V9ZJ34 | 146-299 | None |
| H0WDX6 | 251-416 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.