DPCstruct | MC31765
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 136 ± 15 aa |
| Standard deviation of domain lengths | 15.37 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 38.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11467 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834EMM7 | 1-128 | MDSRLQRIHAEIKNSLKIDNLDVSRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQIIMEKSTMLYNKFKNMFLVGEGDS… |
| A0A1S3I2G1 | 2-132 | EQEIKRTLSVGNADIDKCIAVMEELNNMTIEPVMLQKNPAILKTIKMCRRYKGDSRVQKKSELIYNRFKTMFMVGEGENFSEVFRKA… |
| A0A4W3GDP0 | 30-140 | None |
| A0A224ZA48 | 517-647 | None |
| A0A6P8IWQ8 | 34-163 | None |
| A0A4U5U2J0 | 246-400 | None |
| A0A1S3RDX5 | 137-300 | None |
| A0A3Q3MD31 | 3-135 | None |
| A0A3P8V5W4 | 27-179 | None |
| A0A2P4SZB5 | 46-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.