DPCstruct | MC31764
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 125 ± 12 aa |
| Standard deviation of domain lengths | 11.51 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J6K9F0 | 1-127 | MAAPVCDFVYKKSASTVNLRNIASLTMITDLAILCKYDQFYKSVLFFGEYGQNLKKCYSVVAPGDTIHVIGEFDSEGKCEINREKNF… |
| A0A194QEN6 | 3-96 | RCEVLSAKLNGHVLEVKVQSEDLRATCYIEGICLQEGDIISILAVRNPSGQFHVNNTAGLIVFRPDYLLSSTSVVAGVFCQRKAVLQ… |
| A0A821W0N5 | 206-330 | None |
| A0A1L9VE25 | 498-631 | None |
| A0A7R8ZZB0 | 202-320 | None |
| A0A0N5D152 | 49-177 | None |
| A0A396GW23 | 300-426 | None |
| A0A177DRV8 | 475-608 | None |
| A0A2I0ABX6 | 157-290 | None |
| A0A4S4LGU7 | 112-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.