DPCstruct | MC31763
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 102 ± 6 aa |
| Standard deviation of domain lengths | 6.22 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 75.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 47.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834E8S4 | 1-110 | MWGWLWTEAGAQAELESALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPAISTREPWDGKDG… |
| I2CQT3 | 95-182 | GAQSAAEEALGLTFGFPAVAALSKDKHVFATFKGAFHAASISSFLVGLTTGKESTAPLPPGALKVVKATAWDGREPPVVEEEEFSLED |
| A0A4Y7IR67 | 76-181 | None |
| A0A7R8XFC8 | 636-745 | None |
| A0A7S1VGA1 | 1-100 | None |
| A0A7J5YKJ5 | 584-685 | None |
| A0A2U1N6K4 | 342-442 | None |
| A0A5N6RCU0 | 727-827 | None |
| A0A835P9A2 | 52-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.