DPCstruct | MC31761
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 112 ± 12 aa |
| Standard deviation of domain lengths | 11.91 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 22.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J3CCJ4 | 1-103 | YLGFYTYLIETITAPDAIIRYLCKQYSIHRIPIGNDHTYKNSGKVPNDITYFYTANHRFTVRVSAYSGAKSSSTIEIRPAKLLANSL… |
| A0A0N4THU0 | 1-133 | LGFTCLASDLYTAPDPVKTYLNSVASLHKIPIGTQTTENCLDKVCETLKNSHRLFLTNSLRVRISVSRYSGNLSIRTEALRTSLRLL… |
| A0A1R1XSA2 | 22-134 | None |
| A0A087GGH0 | 526-637 | None |
| A0A250XR24 | 1-120 | None |
| A0A3P7IWD4 | 110-228 | None |
| A0A3P7QJ67 | 147-254 | None |
| A0A7S1EQ16 | 112-242 | None |
| A0A0V1ISA1 | 553-653 | None |
| A0A0L0D5L1 | 523-622 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.