DPCstruct | MC3176
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 190 ± 37 aa |
| Standard deviation of domain lengths | 36.96 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 29.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661D6W6 | 1-123 | MPIIARLYAEDDQERINNIIDLAKKSPRGAGVQLAFAMPDWIALKTLGLKLYRAFITTNFPAGHPFVLFTVDNIGKTLGNYATNWGK… |
| A0A6N8YKV4 | 29-207 | IPLAGSAERIRATVIGASQYTVQVSSSTVFVSNSELLPYLDLQVVPAYLPADPNDLTQEAVEQAIARGFERLDIAEQDIGKHIALAV… |
| A0A849Q6S2 | 68-297 | None |
| A0A842WNI8 | 440-673 | None |
| A0A399YMJ9 | 163-380 | None |
| A0A536HZR8 | 211-394 | None |
| A0A1Y4DJF2 | 60-214 | None |
| A0A1V5HI64 | 106-337 | None |
| A0A2T0KI15 | 317-523 | None |
| A0A447W771 | 10-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.