DPCstruct | MC31759
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 87 ± 17 aa |
| Standard deviation of domain lengths | 17.14 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 90.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 47.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0369 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4TGG9 | 12-87 | GCKNSCLCNEFGHPEWLDFPRLGNNESFYYCRRQWNLVDDELLRYKYLNNFDRAMNQLEQKHHFLSRGPAYTSWKH |
| H2ZI28 | 31-102 | IGNEFGHPDWVELPSPSNNDNFQFARRQFHLADNQQMRYKYLNRFDRAVNKTEERFGWLKSNQAVVTRTHEG |
| A0A5J4NQG9 | 340-421 | None |
| A0A7S3F516 | 12-105 | None |
| A0A813FL99 | 251-348 | None |
| A0A287X443 | 1-75 | None |
| A0A1R3KBC3 | 159-266 | None |
| A0A1B0BXA4 | 27-94 | None |
| A0A2P4Z9T7 | 525-630 | None |
| A0A7J7IFJ2 | 300-382 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.