DPCstruct | MC31755
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 100 ± 9 aa |
| Standard deviation of domain lengths | 8.90 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 36.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N1IJU7 | 1-98 | MSVFSQVPDVAAELSHGCYGFAAAYMHWPEQLIVGGATRNTTSALRSARALQSVVQLMGEREMFEYWADHYKVHHIGWTQEKAAAVL… |
| A0A822E2F2 | 99-191 | TKPLDIALVMNGGCYGLSRKYMHWQEELIIGGTVKNTSGKLTSAKALQTMIQLMTPKQMYEHFKGYIDVSKINWNEEKAAAILEAWQ… |
| A0A1I8IMK0 | 71-160 | None |
| A0A4U8URW8 | 171-281 | None |
| J9AJ15 | 35-140 | None |
| A0A821ZR77 | 98-190 | None |
| A0A6G0HCS7 | 64-155 | None |
| A0A3P8DIE2 | 197-297 | None |
| P18502 | 300-389 | None |
| T1IK19 | 36-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.