DPCstruct | MC31754
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 85 ± 10 aa |
| Standard deviation of domain lengths | 9.50 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4TE63 | 3-86 | LSWMHCNNCYLIASAQNINKNETFALANCGHIFCSTCRDKCVSRKMCMVCQRSPFVYEDVGRHMSEKTKKYFQAPNTLLMNTLQ |
| A0A4U5UYB2 | 2-75 | DWFHCNQCFTRRGSKFLVSSCGHICCEACIKSKQCSVCGASCSYLPITDEMKPQEKSFFKDPVKLIQSRLQHIS |
| F4WJ79 | 2-82 | None |
| A0A0C9Z0F1 | 18-106 | None |
| A0A0R3RVZ7 | 359-452 | None |
| A0A834MPB7 | 4-93 | None |
| A0A6V7X4J6 | 3-84 | None |
| A0A0N5CLT1 | 35-113 | None |
| A0A368EWK5 | 1-75 | None |
| A0A2P8Z4H5 | 2-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.