DPCstruct | MC31743
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 192 ± 14 aa |
| Standard deviation of domain lengths | 14.00 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0715 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7ZA82 | 98-271 | KSVHHNPSKFGIQDEKLKPFEKFLLKLEGQLLDGMIFQACIEQQFDSLNGGVSVSKNSTFAEEFAHSIRSIFANVEARLGEPSEIDQ… |
| A0A0N4TAD6 | 2-190 | QLVAHNPSQFGAESDLLQPLQRLITSIDQSIMKANLYKNCCKQMFERNLQEDHQFNERMKGITIEMFEKWDRVATDDMPDKRKLMAI… |
| W2SZX5 | 25-253 | None |
| A0A482SCV2 | 2-192 | None |
| K1PKW3 | 379-556 | None |
| S4RDB4 | 111-297 | None |
| A0A6V7XZZ8 | 531-737 | None |
| A0A0B2V378 | 41-226 | None |
| A0A553Q8N3 | 210-386 | None |
| A0A7R8VTQ9 | 25-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.