DPCstruct | MC31742
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 79 ± 8 aa |
| Standard deviation of domain lengths | 8.41 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 56.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7FRN4 | 2-68 | EAIEKQINQRKEIAQRLVGTQDDAICQICQKTKFADGIGHKCFYCQLRSCARCGGRTASRNKPIWAC |
| A0A0N4T9J5 | 1-80 | MQLAISNSIKADEELEAIEKQINQRKEIAQRLVGTQDDAICQICQKTKFADGIGHKCFYCQLRSCARCGGRTASRNKVSQ |
| A0A7R9NVB3 | 117-192 | None |
| A0A4Z2HJK1 | 46-115 | None |
| A0A1S3GJL0 | 107-189 | None |
| A0A182G2M6 | 37-114 | None |
| M7BQ39 | 66-144 | None |
| A0A1I8M3T0 | 37-114 | None |
| A0A151PDE4 | 28-110 | None |
| A0A2Y9TGZ8 | 51-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.