DPCstruct | MC31740
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 347 ± 45 aa |
| Standard deviation of domain lengths | 44.56 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.46 |
| Pfam Score | 89.77 |
| Assigned Pfam label(s) | CL0715- PF14744 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G0UBE0 | 166-468 | VQMLMMIRATYHARTGVVATSFDLVVRSIKYVMERHLHELYQAVSETLLHGSSADIEDQYSAIRAAIDLLHKPQTLENLLCLELVFC… |
| A0A0N4T721 | 64-392 | IETIKEIENIFWKWRYDILESCQEASQYCNAKLIHLISAVHQTIRSETDFSYRTVDTLSALTVAENALSSSISRTNLIVASTALEMA… |
| A0A5S6Q1S3 | 16-351 | None |
| T1GY66 | 1-286 | None |
| B4HB68 | 3-296 | None |
| A0A5N5SSL7 | 269-646 | None |
| A4I0W7 | 700-1087 | None |
| A0A482SGZ3 | 11-395 | None |
| A0A0A9VAF3 | 2-348 | None |
| A0A817Z8E5 | 8-395 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.