DPCstruct | MC3174
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 65 ± 3 aa |
| Standard deviation of domain lengths | 3.29 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 41.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C5VKA8 | 318-390 | DAGVIEAYLVAQPGYVTQIADGRLWVIRADSDDLKEFTANGELGKHVTKIGAGPMGMTIKSSDAETIDSYMRN |
| A0A2E7ENS2 | 4-66 | YVAAKDGFVTIIEDGRIWVFLPNSDELKEFEEIGEPAKCVTRPGAGPLQMTVKSVDASTIDAY |
| A0A518BSG9 | 171-232 | None |
| A0A7Y5LZY0 | 14-78 | None |
| A0A2E3DQ26 | 13-77 | None |
| A0A2D9PR54 | 46-111 | None |
| A0A1G1HHQ2 | 109-167 | None |
| A0A7H1JBY9 | 7-70 | None |
| A0A5B9QYI2 | 203-267 | None |
| A0A2S0QV69 | 26-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.