DPCstruct | MC31739
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 105 ± 13 aa |
| Standard deviation of domain lengths | 12.64 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 25.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05652 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M3J5I7 | 10-98 | FEFTRLLRSDTQTKTISILGKINDQDAIVTIEKSQFNTDDLTLKNLITDISLINSNDVYYWSKANLFQDLLSVPGAKLNLIFPATET… |
| A0A0N4T6B0 | 1-104 | MDIMAADEIKITDDTKICNDLKGFKFKEILGEDATRKITFVLLDVNNCNDQAVLIVEKTPFPMDEQDWNTIVSQCSLETLSMNDIYS… |
| A0A094HWY5 | 208-322 | None |
| A0A1V2LHT1 | 3-106 | None |
| C4JEC2 | 348-444 | None |
| A0A482VBJ1 | 406-505 | None |
| A0A4C1UK80 | 16-120 | None |
| A0A2A2KRJ1 | 8-101 | None |
| A0A0D0SZ47 | 6-107 | None |
| C9S675 | 1-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.