DPCstruct | MC31738
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 146 ± 15 aa |
| Standard deviation of domain lengths | 14.69 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 69.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 42.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05867 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4T304 | 1-161 | MKEESDKINSLKKPVSRVIDNDNEGMLFDEDGLPFWSKFSKVQKDSEHSVEVTDDELPMDSEVLLEVQAGLRKLVKMPKIRIVMDPY… |
| A0A0D8XPC0 | 18-165 | ETRGESCVSPPMSTKFETNPQVLSSTGLPCVKNKNNEGKLFVNGVPFWVGNINEDVTDEENVLNAAVILEVASGKLSLVNMPDESII… |
| A0A4U5P1D8 | 322-460 | None |
| A0A0B1T329 | 117-234 | None |
| A0A0J9XUY4 | 222-382 | None |
| A0A183U160 | 1-159 | None |
| A0A0M3HVU9 | 72-221 | None |
| A0A0N4YXW7 | 82-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.