DPCstruct | MC31735
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 219 ± 22 aa |
| Standard deviation of domain lengths | 22.41 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4YS88 | 32-254 | RLQIVPAGIFDHMPHLTFIHFGGIPDVEELPSLSSLGMLRYLTLAILNSLKEIPSFDGLTKLTALNIVEATRATTLPALTPLVSLKS… |
| A0A662YCE5 | 3-241 | GLLALPDGLFDSMHRLTYLHLGVHEVLPRLPSFQGLVNLRYLTLALLGSLREVPAFTHLSNLQLLIISNVPLLETLPDLAPISTSLL… |
| K3WCA3 | 289-514 | None |
| A0A833W9H6 | 108-354 | None |
| K3WG74 | 1-213 | None |
| K3X7V5 | 220-452 | None |
| K3XAC1 | 253-458 | None |
| A0A2P4YSJ6 | 261-477 | None |
| A0A662WM51 | 288-499 | None |
| A0A0W8BZK4 | 512-754 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.