DPCstruct | MC31733
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 306 ± 34 aa |
| Standard deviation of domain lengths | 34.42 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 18.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397C9T6 | 1-261 | MATVQDGVVAALEERVADLSREILERDELIMHLQAEKRELRRWAEQLHHQLHSSNDEPRVDPQDKQHVTDEIELRLSAALDQVKALS… |
| A0A662Y4D6 | 53-408 | DTAVGLPPPSGEQQKPRNASAKAKTRAKDVDESHEEQARFDRALARRKARVESANEASGSLAAGLELKSANDRITQLERQLLHAEET… |
| F0WC15 | 29-373 | None |
| W4GQ57 | 72-376 | None |
| A0A067C5Q5 | 3-283 | None |
| A0A418F617 | 630-932 | None |
| A0A196SGI5 | 95-371 | None |
| A0A196S965 | 421-694 | None |
| A0A024TX68 | 141-492 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.