DPCstruct | MC3173
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 123 ± 13 aa |
| Standard deviation of domain lengths | 13.03 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U6Q1R2 | 10-130 | VPTDEKEFRNENLNKLYEASEDLLYLLNRGYKIKGTSTFIGNHYLLSERQRLALVRGISRYDDVIKRKSKEITNISNIEEVHIDGFN… |
| A0A2E7D7Y4 | 7-133 | HRGPHPEDVQLFAETEVLSLQLACNDLSWLLSRGYASASSVKLVGDRYKLAARQRLAVSRCACSDSDRELRLSRRVSPAETKGKPIW… |
| A0A645B1P5 | 263-380 | None |
| A0A7X9KVE7 | 1-127 | None |
| A0A0S7ZKR2 | 5-113 | None |
| A0A1F3SI82 | 3-125 | None |
| A0A6L9H140 | 4-120 | None |
| A0A1I0FWZ3 | 1-110 | None |
| A0A7C2IKY5 | 115-246 | None |
| A0A662SK34 | 4-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.