DPCstruct | MC31729
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 318 ± 28 aa |
| Standard deviation of domain lengths | 27.87 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3H267 | 10-319 | PTRLFSAVVDKKSCVSSNYCTGGSSPYNGTICTSTSSYQKDVAAVFGSNPYVIVEKYGSGKSCSAAALSSIGTYVADTKCHRSSSST… |
| A0A6A3IC37 | 24-351 | GKGTPGSMPTVVSLYDSCSQPASSVIITRELECSLDDAQTCQSTGVVATNCTNYVSGSDTSGAISEAFGDHPHLIVEEYDPSAMYCG… |
| A0A6A4E5Z3 | 19-343 | None |
| A0A833S8Q2 | 28-367 | None |
| A0A6A4C0K1 | 294-605 | None |
| A0A2P4YTD2 | 124-425 | None |
| A0A662X4J0 | 13-334 | None |
| H3H924 | 1-390 | None |
| H3H266 | 345-613 | None |
| H3H4D8 | 67-388 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.