DPCstruct | MC31726
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 93 ± 24 aa |
| Standard deviation of domain lengths | 24.22 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 74.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.97 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 81.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3GX88 | 1-150 | MSPKTVKAVARAQALEAYMSRRDDPPAAAKEPQVITNAGVDEGVPPELLQPENRQHLADRSRQEASQAVGTKRDRETHAPRTSEKLL… |
| A0A6A3WVH1 | 1-65 | MSPKTVVAVERARLLEASMSRRDDPPAAVSEPRVITNAGVDEGVPPELLQPDNRQHLADRTHQEA |
| A0A6A3IU98 | 121-214 | None |
| A0A6A4ART3 | 28-90 | None |
| A0A6A3QAZ2 | 1-91 | None |
| A0A6G0QIB9 | 56-135 | None |
| A0A6G0QN22 | 1-91 | None |
| A0A6A3VAS7 | 150-214 | None |
| A0A6A3KZZ3 | 165-236 | None |
| A0A6A4EKL0 | 239-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.