DPCstruct | MC3172
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 83 ± 6 aa |
| Standard deviation of domain lengths | 5.83 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 54.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I4CF86 | 1-76 | MTEQKRLNEAREAGVAWKKWGPYLSERQWGTVREDYSEDGNAWDYFSHDQARSRAYRWGEDGLGGISDDRQRLCFA |
| A0A2E7D5G4 | 1-81 | MSTSAETQHLAAAANRDPDGNWKRWGPYLSERQWGTVREDYSPDGEPWDYFPFEHSHQRAYRWGEDGLLGITDRECRLCFA |
| A0A6C1DYW0 | 11-86 | None |
| A0A1F7RS87 | 1-84 | None |
| A0A5N5PU10 | 1-96 | None |
| A0A3E1DJV8 | 6-90 | None |
| A0A849ZV15 | 1-89 | None |
| A0A6A4X7V9 | 378-455 | None |
| A0A813CT11 | 627-711 | None |
| A0A813GEZ1 | 35-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.