DPCstruct | MC31712
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 70 ± 8 aa |
| Standard deviation of domain lengths | 7.53 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 60.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6K1L5 | 291-364 | CAFIDAEHALDTVYARKLGVNVGDLIVSQPDTGEQALHIVEYLVCSGAIDVIVVDSVAALTPRAEIEGDMGDQH |
| A0A077ZM69 | 260-336 | KTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHM |
| Q94CQ8 | 28-85 | None |
| A0A090AKV8 | 87-163 | None |
| K8AZ63 | 452-528 | None |
| A0A7J7GYV7 | 229-289 | None |
| A0A6P8EJY9 | 74-146 | None |
| A0A067JTE1 | 147-204 | None |
| A0A6D2L2X1 | 524-583 | None |
| A0A380FHZ5 | 12-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.