DPCstruct | MC31711
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 72 ± 4 aa |
| Standard deviation of domain lengths | 4.38 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 72.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0268- PF00995 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7PHY1 | 151-222 | KINKLIREIGLRDIGQLEQDVVFGDAGAKEVISFLRTKQDLSPENKLRLLMIYAVVYPEKFEGDKGEKLMQL |
| A0A822XME6 | 905-980 | EIAGKINRLIRELGLRDLGQLEQDLVFGDAGAKEVINFLRTNQDATPENKLRLLMIYSIVYPEKFEADKGVKLMQL |
| A0A2G3B4H2 | 92-163 | None |
| A0A7J7H1A9 | 105-180 | None |
| A0A6S7NG25 | 21-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.