DPCstruct | MC3171
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 152 ± 28 aa |
| Standard deviation of domain lengths | 28.30 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 88.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F7XJX4 | 252-400 | AGQPISKLEERLRPGNDSMMGFLGQNESLISILADDNDFVLSHDLTHQDLALPLFYAREHYLQGKGREFTYKGRKFSIQATAYRGMQ… |
| A0A2E7D4L0 | 79-233 | NGISIADLERQMRPGAEGKEGSTAGFLGKSESLLTVLAQDNAYVVDQLELTHQGLARPMLAIANYARENNTSRVTWRGILFYVEIEE… |
| A0A7V9L5M8 | 264-407 | None |
| A0A7W1HGI6 | 5-127 | None |
| A0A150PRH9 | 10-198 | None |
| A0A1G2YPA2 | 7-150 | None |
| A0A7X8EZ02 | 1-126 | None |
| A0A3N9N114 | 92-285 | None |
| A0A3D3UY68 | 414-607 | None |
| A0A1W9HX76 | 255-403 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.