DPCstruct | MC31707
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 139 ± 24 aa |
| Standard deviation of domain lengths | 23.66 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A1ULY5 | 30-157 | AHNGRPGFLFSRTRGRCTPQYWSSRGESWPRMVPKGSTVSKVFGSRASERYRADLTLFEATARNDEENSFRKLLKQASAALLNSYAR… |
| A0A6J6CTE6 | 27-168 | SNTATASASATVTSFWFGRSPGFWKNHSELWMSGYTPSMNIQSVFTIPSALLSGSNLDLDKNGTRDTLMAGLGYKGGSTLAGAAQIL… |
| A0A2I0HQ70 | 127-265 | None |
| A0A2N0WTZ4 | 604-726 | None |
| A0A427BBV9 | 47-187 | None |
| A0A535PY39 | 324-456 | None |
| A0A4P1RP21 | 733-869 | None |
| A0A4P1R5T4 | 652-796 | None |
| A0A7Y8JIF7 | 1-183 | None |
| A0A238VXV0 | 410-550 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.