DPCstruct | MC31705
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 56 ± 3 aa |
| Standard deviation of domain lengths | 2.94 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 80.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 58.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01679 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A1UIW5 | 1-54 | MGSQTFLEVLLAILLPPVGVFLRYGCGVEFWIDLLLTILGYIPGIIYAVYVITR |
| A0A3M1WYF9 | 33-91 | PEAEKGLIGKIILLILAFILPPLAVFFKVGFGIQFWLNILLTLLGILPGIIHAILVITD |
| G2Y8T2 | 1-58 | None |
| A0A3L6QUX4 | 392-447 | None |
| Q9LRI7 | 3-58 | None |
| A0A4U0X8Z8 | 3-55 | None |
| A0A7J7KWT2 | 257-310 | None |
| A0A2N9IF67 | 147-200 | None |
| A0A2S8GRV8 | 7-61 | None |
| K7VI07 | 1-54 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.