DPCstruct | MC31704
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 149 ± 28 aa |
| Standard deviation of domain lengths | 27.97 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 76.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D5A963 | 5-125 | SKQKLNWEYEADMLAAFAKDPLLCMRAICALYRQQTNEEKRGKSSLYQNRRGFDKLHALRGSLLAEFLTENDPFGPMKKSVQDLEKH… |
| A0A6A1UGR5 | 3-140 | DDSSSSSDSDDSFSFLNHTSLLGPRNRNNPCFEFEEDMIAEFEKDAELCMKAVCALYRQQTSVSKSPMCLEFSSNQSPGFNKYDALR… |
| A0A4Y7IIM7 | 594-747 | None |
| A0A7J0FRZ5 | 1-196 | None |
| A0A0D9V3P7 | 271-455 | None |
| A0A2U1QCS2 | 133-264 | None |
| A0A2U1QMI8 | 391-509 | None |
| A0A1U8FJX8 | 22-135 | None |
| A0A4Y7KU81 | 483-647 | None |
| A0A2Z6M7M0 | 363-545 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.