DPCstruct | MC31703
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 126 ± 17 aa |
| Standard deviation of domain lengths | 16.89 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A496MQV6 | 1-146 | GIWCFYSKIGKLERKVNQDENYKFSIRQLIEKVKKEYHINLELKEERGYVSRFNENGKYYYHLILFPKDIYDEPTQHIMIDGQTGKN… |
| A0A242NYD0 | 78-195 | VKKWIYFNDKQEIIKEIDNDQPYPFSIEALAELLKDNYGINLYDPRQILVMQRYIDTTNTHKPVYVVYAFQKNSTNKLDGLLIDGET… |
| A0A250FQW8 | 130-244 | None |
| A0A7H8PR64 | 73-172 | None |
| U2ANE6 | 107-253 | None |
| C9MS65 | 1-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.