DPCstruct | MC317
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 110 ± 7 aa |
| Standard deviation of domain lengths | 7.35 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C5KLU1 | 7-121 | ISSGLKMLLSKAEKMGWNWDAYIEPDNRRTYVEIGQASPAGEDFSMIIDFKEKDQAKSFKENLQMYYEDFDVDEHIEMWIEARHNGI… |
| A0A1I0YD98 | 5-112 | ETLQEICNGTNWEPEHEDGNTYGFRWTGGDYDGYIILSGDTISDLEDDAYVAYENFDVDEETALWIGEDGHGKNGAPYRIRDILEEF… |
| A0A3S4ZHE8 | 2-108 | None |
| C2MEK1 | 10-110 | None |
| D4KC92 | 1-104 | None |
| A0A1Y4HA64 | 126-228 | None |
| A0A415U0Z9 | 6-117 | None |
| A0A350TI18 | 105-222 | None |
| A0A415HVD4 | 1-105 | None |
| A0A316L8N7 | 89-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.