DPCstruct | MC31696
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 147 ± 18 aa |
| Standard deviation of domain lengths | 17.69 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 28.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04270 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W1VNY6 | 83-220 | KQLYALPLSQRHVESDGLLFDPAQITKKTANGVAVPHGDHYHFIPYSQMSALEEKISRIIPVKGQNNGNNKPVNTQKPTNSTVEHTF… |
| A0A806E380 | 53-236 | KPLSERHVESDGLVFDPAQITSRTARGVAVPHGNHYHFIPYEQMSELEERIARIIPLRYRSNHWVPDSRPEQPSPQPTPEPSPSPQP… |
| A5LKQ2 | 34-181 | None |
| Q8DQ06 | 3-157 | None |
| G5K621 | 58-194 | None |
| A0A7U0UDA6 | 1-124 | None |
| A0A4V0EE03 | 144-283 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.