DPCstruct | MC31692
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 253 ± 18 aa |
| Standard deviation of domain lengths | 17.86 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 43.45 |
| Pfam Score | 90.28 |
| Assigned Pfam label(s) | PF00925- PF12471 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A094A771 | 161-406 | GGSYSIYYALAVASKEIELDHKPDFTNTEPASNIGPFPQWADKEKIVSLDPLGHLAPWLFKNTMDSENIDIRPTIAITKARMNLPEL… |
| A0A0D2XBZ3 | 22-268 | GGSYSIYYALAVASNELNADHRPDFTNTEPAANIGPFPQWGDPKKIVAMDPWGHLAPWLFKDTIEKDNVDIRPTIAITKAHMKLPEL… |
| A0A554IUP7 | 37-303 | None |
| A0A5D3AKL5 | 688-942 | None |
| D7FLZ3 | 64-368 | None |
| A0A1Q9CWW2 | 195-419 | None |
| A0A401KZ29 | 662-906 | None |
| I8A6V4 | 4-273 | None |
| A0A1E3H3M0 | 56-321 | None |
| A0A2U3DR06 | 238-493 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.