DPCstruct | MC3169
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 241 ± 13 aa |
| Standard deviation of domain lengths | 13.02 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 14.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E9MAC5 | 6-256 | DFARSFLWWRIDTSKLPLGTVTLPPPYPTNNARMPLDCLCTVREGTRQRRFALGDSCKTEAVGAERDIWPQPNSDFIQVLSDDGEAI… |
| A0A2E7D3V5 | 1-254 | MPDQWVLSLEQNSETEVIKGSIVETADAVRRGADLRLFLIAKDYEETLYFQQTYAGEQDAFAGLMTHHHSYAHRGSLAEQPYFSFFK… |
| A0A7D9MFA7 | 100-329 | None |
| A0A210PRE8 | 384-617 | None |
| A0A7R9AAV7 | 154-402 | None |
| A0A3S1B8M3 | 331-550 | None |
| A0A1T4L2K0 | 1-258 | None |
| A0A2T7NW35 | 61-307 | None |
| A0A6J8A476 | 141-365 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.