DPCstruct | MC31687
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 236 ± 44 aa |
| Standard deviation of domain lengths | 44.25 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 24.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G4TYN3 | 480-703 | PEAIKVSEQEWPSLSVFSLGTGATTKVYDIGLVNSLERLTLSSRSIATATIHYLAIHPTELPLLDTLELYTCPEWDILFIMLEKRLL… |
| A0A0C3BLR8 | 41-246 | CNDFCELILRYPASCKSLHTLEMRAYPEWDILLHMVQRRNLLPGLGVARLTTLKIPGYPAPLLLVPLTELLGGRPPKPMPSIDELCL… |
| G4TRW6 | 641-882 | None |
| G4TE52 | 365-613 | None |
| A0A0C3BP21 | 1-179 | None |
| A0A0C3BIB7 | 137-382 | None |
| A0A0C3AQY6 | 299-538 | None |
| A0A0C3AVZ4 | 473-772 | None |
| A0A0C3AKF9 | 324-526 | None |
| A0A0C3AK01 | 245-431 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.