DPCstruct | MC31685
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 251 ± 24 aa |
| Standard deviation of domain lengths | 23.85 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 70.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U9STP0 | 69-327 | PKRSNSNSSIIEESGGNDANNELDFKENIRRVLKAQKSDLETQIKYGKDLAEHIPGLYRLLDLCKDDGSNGLVDKIIISKGSLKILC… |
| A0A0C3B065 | 34-286 | LQTPAPDPDVVPSPMGIDEPVTSAPSMDLVHQIPGLYRLLDLVQERGSGGMVDKVIISQESIKKFANTIRPGSYKSEIQVDFKGLDQ… |
| A0A2N0S1D5 | 20-224 | None |
| A0A2I1EUL2 | 24-315 | None |
| A0A485KE72 | 1-239 | None |
| A0A3F2S1U2 | 13-276 | None |
| A0A6G0QN44 | 1-232 | None |
| G4ZF33 | 4-244 | None |
| A0A6A3KIB0 | 7-243 | None |
| W2JYZ6 | 1-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.