DPCstruct | MC31677
Metacluster Properties and Pfam Annotations
| Number of structural domains | 97 |
|---|---|
| Mean domain length (aa) | 119 ± 18 aa |
| Standard deviation of domain lengths | 17.57 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 31.65 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | PF00137- PF20114- PF00507 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V6QED6 | 192-307 | SGYVPVAIFAALIVGFGVVSLAIAWLLRPSRPDIVKLMNYECGAEPIGPAWVRFPVGFYLVALVFIVFDALAVFLVPWLLVLKPLGL… |
| A0A3A4NNX8 | 7-126 | AALIFLLAAIAFVAFNVLVPRLFRPIRPDQEKLSNYECGERPIGGPWIRFNIRFYIIAIIFLIFDVEVLFIIPWAVVYRRLYSELGM… |
| A0A368PE57 | 2-95 | None |
| A0A445CQK6 | 363-476 | None |
| A0A838SUF5 | 37-135 | None |
| A0A2E3HWW1 | 8-126 | None |
| A0A852YW63 | 2-91 | None |
| A0A4S8I587 | 241-351 | None |
| A0A562RW74 | 57-177 | None |
| M6E9N7 | 125-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.